Lineage for d1n60b2 (1n60 B:147-809)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511393Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 511394Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 511395Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (5 proteins)
  6. 511402Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 511408Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56011] (5 PDB entries)
  8. 511411Domain d1n60b2: 1n60 B:147-809 [80069]
    Other proteins in same PDB: d1n60a1, d1n60a2, d1n60b1, d1n60c1, d1n60c2, d1n60d1, d1n60d2, d1n60e1, d1n60f1, d1n60f2

Details for d1n60b2

PDB Entry: 1n60 (more details), 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form

SCOP Domain Sequences for d1n60b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n60b2 d.133.1.1 (B:147-809) Carbon monoxide (CO) dehydrogenase molybdoprotein {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOP Domain Coordinates for d1n60b2:

Click to download the PDB-style file with coordinates for d1n60b2.
(The format of our PDB-style files is described here.)

Timeline for d1n60b2: