Lineage for d1n60b1 (1n60 B:7-146)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602004Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 602005Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 602006Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 602019Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 602025Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [54673] (5 PDB entries)
  8. 602028Domain d1n60b1: 1n60 B:7-146 [80068]
    Other proteins in same PDB: d1n60a1, d1n60a2, d1n60b2, d1n60c1, d1n60c2, d1n60d1, d1n60d2, d1n60e2, d1n60f1, d1n60f2

Details for d1n60b1

PDB Entry: 1n60 (more details), 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form

SCOP Domain Sequences for d1n60b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n60b1 d.41.1.1 (B:7-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
veptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshahariks
idtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakdr
yvaadaielvevdyeplpvl

SCOP Domain Coordinates for d1n60b1:

Click to download the PDB-style file with coordinates for d1n60b1.
(The format of our PDB-style files is described here.)

Timeline for d1n60b1: