Lineage for d1n60a2 (1n60 A:3-81)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503259Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2503286Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (3 species)
  7. 2503292Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54321] (6 PDB entries)
  8. 2503295Domain d1n60a2: 1n60 A:3-81 [80067]
    Other proteins in same PDB: d1n60a1, d1n60b1, d1n60b2, d1n60c1, d1n60c2, d1n60d1, d1n60e1, d1n60e2, d1n60f1, d1n60f2
    complexed with fad, fes, mcn, omo, po4

Details for d1n60a2

PDB Entry: 1n60 (more details), 1.19 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Cyanide-inactivated Form
PDB Compounds: (A:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1n60a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n60a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

SCOPe Domain Coordinates for d1n60a2:

Click to download the PDB-style file with coordinates for d1n60a2.
(The format of our PDB-style files is described here.)

Timeline for d1n60a2: