SCOP 1.63: Domain d1n5zb_: 1n5z B:

Lineage for d1n5zb_ (1n5z B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.34: SH3-like barrel [50036] (12 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (1 family)

5. Family b.34.2.1: SH3-domain [50045] (24 proteins)

6. Protein Peroxisomal membrane protein Pex13p [82055] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (2 PDB entries)

8. Domain d1n5zb_: 1n5z B: [80065]
   complexed with a peptide of pex14p, chains P and Q

Details for d1n5zb_

PDB Entry: 1n5z, 2.7 Å

PDB Description: Complex structure of Pex13p SH3 domain with a peptide of Pex14p

SCOP Domain Sequences for d1n5zb_:

Sequence; same for both SEQRES and ATOM records:

>d1n5zb_ b.34.2.1 (B:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae)}
psklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyipy
nyieiikrr

Timeline for d1n5zb_:

• d1n5zb_ is new in SCOP 1.63
  
• d1n5zb_ appears in SCOP 1.65
  
• d1n5zb_ appears in the current release, SCOPe 2.08