Lineage for d1n5zb_ (1n5z B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2377332Protein Peroxisomal membrane protein Pex13p [82055] (1 species)
  7. 2377333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82056] (3 PDB entries)
  8. 2377339Domain d1n5zb_: 1n5z B: [80065]
    complexed with a peptide of pex14p, chains P and Q

Details for d1n5zb_

PDB Entry: 1n5z (more details), 2.7 Å

PDB Description: Complex structure of Pex13p SH3 domain with a peptide of Pex14p
PDB Compounds: (B:) peroxisomal membrane protein pas20

SCOPe Domain Sequences for d1n5zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5zb_ b.34.2.1 (B:) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
psklefaralydfvpenpemevalkkgdlmailskkdplgrdsdwwkvrtkngnigyipy
nyieiikrr

SCOPe Domain Coordinates for d1n5zb_:

Click to download the PDB-style file with coordinates for d1n5zb_.
(The format of our PDB-style files is described here.)

Timeline for d1n5zb_: