Lineage for d1n5yl1 (1n5y L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219437Species Fab 28 against HIV-1 RT (mouse), kappa L chain [48857] (5 PDB entries)
  8. 219443Domain d1n5yl1: 1n5y L:1-107 [80062]
    Other proteins in same PDB: d1n5ya1, d1n5ya2, d1n5yb_, d1n5yh2, d1n5yl2

Details for d1n5yl1

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)

SCOP Domain Sequences for d1n5yl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5yl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab 28 against HIV-1 RT (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscsasqdissylnwyqqkpegtvklliyytsslhsgvps
rfsgsgsgtdysltisnlepediatyycqqyskfpwtfgggtkleik

SCOP Domain Coordinates for d1n5yl1:

Click to download the PDB-style file with coordinates for d1n5yl1.
(The format of our PDB-style files is described here.)

Timeline for d1n5yl1: