Lineage for d1n5yh1 (1n5y H:1-123)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2739730Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740552Species Mouse (Mus musculus), cluster 6 [TaxId:10090] [88556] (12 PDB entries)
    SQ NA # part of Fab 28 against HIV-1 RT
  8. 2740564Domain d1n5yh1: 1n5y H:1-123 [80060]
    Other proteins in same PDB: d1n5ya1, d1n5ya2, d1n5yb_, d1n5yh2, d1n5yl1, d1n5yl2
    part of Fab 28 against HIV-1 RT
    protein/DNA complex; complexed with mg

Details for d1n5yh1

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)
PDB Compounds: (H:) monoclonal antibody (heavy chain)

SCOPe Domain Sequences for d1n5yh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5yh1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]}
qitlkesgpgivqpsqpfrltctfsgfslstsgigvtwirqpsgkglewlatiwwdddnr
ynpslksrltvskdtsnnqaflnmmtvetadtaiyycaqsaitsvtdsamdhwgqgtsvt
vss

SCOPe Domain Coordinates for d1n5yh1:

Click to download the PDB-style file with coordinates for d1n5yh1.
(The format of our PDB-style files is described here.)

Timeline for d1n5yh1: