Lineage for d1n5ya1 (1n5y A:430-558)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493669Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2493720Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2493730Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 2493832Domain d1n5ya1: 1n5y A:430-558 [80057]
    Other proteins in same PDB: d1n5ya2, d1n5yb_, d1n5yh1, d1n5yh2, d1n5yl1, d1n5yl2
    protein/DNA complex; complexed with mg

Details for d1n5ya1

PDB Entry: 1n5y (more details), 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)
PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1n5ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ya1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOPe Domain Coordinates for d1n5ya1:

Click to download the PDB-style file with coordinates for d1n5ya1.
(The format of our PDB-style files is described here.)

Timeline for d1n5ya1: