SCOPe 2.08: Domain d1n5ya1: 1n5y A:430-558

Lineage for d1n5ya1 (1n5y A:430-558)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (104 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d1n5ya1: 1n5y A:430-558 [80057]
   Other proteins in same PDB: d1n5ya2, d1n5yb_, d1n5yh1, d1n5yh2, d1n5yl1, d1n5yl2
   protein/DNA complex; complexed with mg

Details for d1n5ya1

PDB Entry: 1n5y, 3.1 Å

PDB Description: hiv-1 reverse transcriptase crosslinked to post-translocation aztmp- terminated dna (complex p)

PDB Compounds: (A:) reverse transcriptase

SCOPe Domain Sequences for d1n5ya1:

Sequence; same for both SEQRES and ATOM records:

>d1n5ya1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

Timeline for d1n5ya1:

• d1n5ya1 first appeared in SCOP 1.63
  
• d1n5ya1 appears in SCOPe 2.07