Lineage for d1n5wf2 (1n5w F:1-177)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 263140Fold d.145: FAD-binding domain [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 263141Superfamily d.145.1: FAD-binding domain [56176] (3 families) (S)
  5. 263192Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (3 proteins)
  6. 263193Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 263199Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56189] (5 PDB entries)
  8. 263209Domain d1n5wf2: 1n5w F:1-177 [80056]
    Other proteins in same PDB: d1n5wa1, d1n5wa2, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wd1, d1n5wd2, d1n5we1, d1n5we2, d1n5wf1
    complexed with cum, fad, fes, mcn, po4

Details for d1n5wf2

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

SCOP Domain Sequences for d1n5wf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wf2 d.145.1.3 (F:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOP Domain Coordinates for d1n5wf2:

Click to download the PDB-style file with coordinates for d1n5wf2.
(The format of our PDB-style files is described here.)

Timeline for d1n5wf2: