Lineage for d1n5we2 (1n5w E:147-809)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262389Fold d.133: Molybdemum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 262390Superfamily d.133.1: Molybdemum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 262391Family d.133.1.1: Molybdemum cofactor-binding domain [56004] (4 proteins)
  6. 262397Protein Carbon monoxide (CO) dehydrogenase molybdoprotein [56010] (2 species)
  7. 262403Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [56011] (5 PDB entries)
  8. 262413Domain d1n5we2: 1n5w E:147-809 [80054]
    Other proteins in same PDB: d1n5wa1, d1n5wa2, d1n5wb1, d1n5wc1, d1n5wc2, d1n5wd1, d1n5wd2, d1n5we1, d1n5wf1, d1n5wf2
    complexed with cum, fad, fes, mcn, po4

Details for d1n5we2

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

SCOP Domain Sequences for d1n5we2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5we2 d.133.1.1 (E:147-809) Carbon monoxide (CO) dehydrogenase molybdoprotein {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
vdpfkamepdapllredikdkmtgahgarkhhnhifrweigdkegtdatfakaevvskdm
ftyhrvhpspletcqcvasmdkikgeltlwgtfqaphvirtvvslisglpehkihviapd
igggfgnkvgaysgyvcavvasivlgvpvkwvedrmenlsttsfardyhmttelaatkdg
kilamrchvladhgafdacadpskwpagfmnictgsydmpvahlavdgvytnkasggvay
rcsfrvteavyaieraietlaqrlemdsadlriknfiqpeqfpymaplgweydsgnypla
mkkamdtvgyhqlraeqkakqeafkrgetreimgigisffteivgagpskncdilgvsmf
dsaeirihptgsviarmgtksqgqghettyaqiiatelgipaddimieegntdtapyglg
tygsrstptagaatavaarkikakaqmiaahmlevhegdlewdvdrfrvkglpekfktmk
elawasynspppnlepgleavnyydppnmtypfgayfcimdidvdtgvaktrrfyalddc
gtrinpmiiegqvhgglteafavamgqeirydeqgnvlgasfmdfflptavetpkwetdy
tvtpsphhpigakgvgesphvggvpcfsnavndayaflnaghiqmphdawrlwkvgeqlg
lhv

SCOP Domain Coordinates for d1n5we2:

Click to download the PDB-style file with coordinates for d1n5we2.
(The format of our PDB-style files is described here.)

Timeline for d1n5we2: