SCOP 1.73: Domain d1n5wd2: 1n5w D:3-81

Lineage for d1n5wd2 (1n5w D:3-81)

Root: SCOP 1.73
Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54321] (5 PDB entries)
Domain d1n5wd2: 1n5w D:3-81 [80052]
Other proteins in same PDB: d1n5wa1, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd1, d1n5we1, d1n5we2, d1n5wf1, d1n5wf2
complexed with cum, fad, fes, mcn, po4

Details for d1n5wd2

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOP Domain Sequences for d1n5wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wd2 d.15.4.2 (D:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

SCOP Domain Coordinates for d1n5wd2:

Click to download the PDB-style file with coordinates for d1n5wd2.
(The format of our PDB-style files is described here.)

Timeline for d1n5wd2: