SCOPe 2.01: Domain d1n5wd1: 1n5w D:82-160

Lineage for d1n5wd1 (1n5w D:82-160)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins)

6. Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)

7. Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [47749] (5 PDB entries)

8. Domain d1n5wd1: 1n5w D:82-160 [80051]
   Other proteins in same PDB: d1n5wa2, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd2, d1n5we1, d1n5we2, d1n5wf1, d1n5wf2
   complexed with cum, fad, fes, mcn, po4

Details for d1n5wd1

PDB Entry: 1n5w, 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

PDB Compounds: (D:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1n5wd1:

Sequence; same for both SEQRES and ATOM records:

>d1n5wd1 a.56.1.1 (D:82-160) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvp

Timeline for d1n5wd1:

• d1n5wd1 first appeared in SCOP 1.63
  
• d1n5wd1 appears in SCOP 1.75
  
• d1n5wd1 appears in SCOPe 2.02
  
• d1n5wd1 appears in the current release, SCOPe 2.08