Lineage for d1n5wd1 (1n5w D:82-160)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356706Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 356707Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 356708Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 356714Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 356720Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [47749] (5 PDB entries)
  8. 356728Domain d1n5wd1: 1n5w D:82-160 [80051]
    Other proteins in same PDB: d1n5wa2, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd2, d1n5we1, d1n5we2, d1n5wf1, d1n5wf2
    complexed with cum, fad, fes, mcn, po4

Details for d1n5wd1

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

SCOP Domain Sequences for d1n5wd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wd1 a.56.1.1 (D:82-160) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvp

SCOP Domain Coordinates for d1n5wd1:

Click to download the PDB-style file with coordinates for d1n5wd1.
(The format of our PDB-style files is described here.)

Timeline for d1n5wd1: