Lineage for d1n5wc2 (1n5w C:1-177)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547987Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2547994Protein Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain [56188] (2 species)
  7. 2548000Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [56189] (5 PDB entries)
  8. 2548009Domain d1n5wc2: 1n5w C:1-177 [80050]
    Other proteins in same PDB: d1n5wa1, d1n5wa2, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wd1, d1n5wd2, d1n5we1, d1n5we2, d1n5wf1
    complexed with cum, fad, fes, mcn, po4

Details for d1n5wc2

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form
PDB Compounds: (C:) Carbon monoxide dehydrogenase medium chain

SCOPe Domain Sequences for d1n5wc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wc2 d.145.1.3 (C:1-177) Carbon monoxide (CO) dehydrogenase flavoprotein, N-terminal domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
mipgsfdyhrpksiadavalltklgedarplagghslipimktrlatpehlvdlrdigdl
vgireegtdvvigamttqhaligsdflaaklpiiretslliadpqirymgtiggnaangd
pgndmpalmqclgaayeltgpegarivaardyyqgayftaiepgelltairipvppt

SCOPe Domain Coordinates for d1n5wc2:

Click to download the PDB-style file with coordinates for d1n5wc2.
(The format of our PDB-style files is described here.)

Timeline for d1n5wc2: