Lineage for d1n5wb1 (1n5w B:6-146)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 256251Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 256252Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (1 family) (S)
  5. 256253Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (4 proteins)
  6. 256259Protein Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain [54672] (2 species)
  7. 256265Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [54673] (5 PDB entries)
  8. 256274Domain d1n5wb1: 1n5w B:6-146 [80047]
    Other proteins in same PDB: d1n5wa1, d1n5wa2, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd1, d1n5wd2, d1n5we2, d1n5wf1, d1n5wf2

Details for d1n5wb1

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

SCOP Domain Sequences for d1n5wb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wb1 d.41.1.1 (B:6-146) Carbon monoxide (CO) dehydrogenase molybdoprotein, N-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
tveptsaeraeklqgmgckrkrvedirftqgkgnyvddvklpgmlfgdfvrsshaharik
sidtskakalpgvfavltaadlkplnlhymptlagdvqavladekvlfqnqevafvvakd
ryvaadaielvevdyeplpvl

SCOP Domain Coordinates for d1n5wb1:

Click to download the PDB-style file with coordinates for d1n5wb1.
(The format of our PDB-style files is described here.)

Timeline for d1n5wb1: