Lineage for d1n5wa2 (1n5w A:3-81)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1195552Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1195703Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins)
  6. 1195721Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)
  7. 1195727Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [54321] (6 PDB entries)
  8. 1195736Domain d1n5wa2: 1n5w A:3-81 [80046]
    Other proteins in same PDB: d1n5wa1, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd1, d1n5we1, d1n5we2, d1n5wf1, d1n5wf2
    complexed with cum, fad, fes, mcn, po4

Details for d1n5wa2

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form
PDB Compounds: (A:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1n5wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wa2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

SCOPe Domain Coordinates for d1n5wa2:

Click to download the PDB-style file with coordinates for d1n5wa2.
(The format of our PDB-style files is described here.)

Timeline for d1n5wa2: