SCOP 1.69: Domain d1n5wa2: 1n5w A:3-81

Lineage for d1n5wa2 (1n5w A:3-81)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (12 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (11 proteins)

6. Protein Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain [54320] (2 species)

7. Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [54321] (5 PDB entries)

8. Domain d1n5wa2: 1n5w A:3-81 [80046]
   Other proteins in same PDB: d1n5wa1, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd1, d1n5we1, d1n5we2, d1n5wf1, d1n5wf2

Details for d1n5wa2

PDB Entry: 1n5w, 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

SCOP Domain Sequences for d1n5wa2:

Sequence; same for both SEQRES and ATOM records:

>d1n5wa2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
kahieltinghpvealveprtllihfireqqnltgahigcdtshcgactvdldgmsvksc
tmfavqangasittiegma

Timeline for d1n5wa2:

• d1n5wa2 first appeared in SCOP 1.63
  
• d1n5wa2 appears in SCOP 1.67
  
• d1n5wa2 appears in SCOP 1.71
  
• d1n5wa2 appears in the current release, SCOPe 2.08