Lineage for d1n5wa1 (1n5w A:82-163)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282205Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 282206Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 282207Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 282213Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)
  7. 282219Species Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans) [47749] (5 PDB entries)
  8. 282228Domain d1n5wa1: 1n5w A:82-163 [80045]
    Other proteins in same PDB: d1n5wa2, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd2, d1n5we1, d1n5we2, d1n5wf1, d1n5wf2

Details for d1n5wa1

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form

SCOP Domain Sequences for d1n5wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wa1 a.56.1.1 (A:82-163) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans (formerly Pseudomonas carboxydovorans)}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvpfee

SCOP Domain Coordinates for d1n5wa1:

Click to download the PDB-style file with coordinates for d1n5wa1.
(The format of our PDB-style files is described here.)

Timeline for d1n5wa1: