Lineage for d1n5wa1 (1n5w A:82-163)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998451Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1998452Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1998453Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 protein domains)
  6. 1998476Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (3 species)
  7. 1998482Species Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId:40137] [47749] (6 PDB entries)
  8. 1998491Domain d1n5wa1: 1n5w A:82-163 [80045]
    Other proteins in same PDB: d1n5wa2, d1n5wb1, d1n5wb2, d1n5wc1, d1n5wc2, d1n5wd2, d1n5we1, d1n5we2, d1n5wf1, d1n5wf2
    complexed with cum, fad, fes, mcn, po4

Details for d1n5wa1

PDB Entry: 1n5w (more details), 1.5 Å

PDB Description: Crystal Structure of the Cu,Mo-CO Dehydrogenase (CODH); Oxidized form
PDB Compounds: (A:) Carbon monoxide dehydrogenase small chain

SCOPe Domain Sequences for d1n5wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5wa1 a.56.1.1 (A:82-163) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]}
apdgtlsalqegfrmmhglqcgyctpgmimrshrllqenpspteaeirfgiggnlcrctg
yqnivkaiqyaaakingvpfee

SCOPe Domain Coordinates for d1n5wa1:

Click to download the PDB-style file with coordinates for d1n5wa1.
(The format of our PDB-style files is described here.)

Timeline for d1n5wa1: