Lineage for d1n5sa_ (1n5s A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 257061Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 257289Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (3 families) (S)
    dimerises through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 257299Family d.58.4.3: Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82666] (1 protein)
  6. 257300Protein Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82667] (1 species)
  7. 257301Species Streptomyces coelicolor [TaxId:1902] [82668] (5 PDB entries)
  8. 257306Domain d1n5sa_: 1n5s A: [80039]

Details for d1n5sa_

PDB Entry: 1n5s (more details), 1.7 Å

PDB Description: Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with the ligand Acetyl Dithranol

SCOP Domain Sequences for d1n5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5sa_ d.58.4.3 (A:) Actinorhodin biosynthesis monooxygenase ActVa-Orf6 {Streptomyces coelicolor}
aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps

SCOP Domain Coordinates for d1n5sa_:

Click to download the PDB-style file with coordinates for d1n5sa_.
(The format of our PDB-style files is described here.)

Timeline for d1n5sa_: