Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.58: Ferredoxin-like [54861] (44 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (3 families) dimerises through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.3: Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82666] (1 protein) |
Protein Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82667] (1 species) |
Species Streptomyces coelicolor [TaxId:1902] [82668] (5 PDB entries) |
Domain d1n5sa_: 1n5s A: [80039] |
PDB Entry: 1n5s (more details), 1.7 Å
SCOP Domain Sequences for d1n5sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5sa_ d.58.4.3 (A:) Actinorhodin biosynthesis monooxygenase ActVa-Orf6 {Streptomyces coelicolor} aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps
Timeline for d1n5sa_: