Lineage for d1n5qb_ (1n5q B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026927Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1026965Family d.58.4.3: Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82666] (1 protein)
  6. 1026966Protein Actinorhodin biosynthesis monooxygenase ActVa-Orf6 [82667] (1 species)
  7. 1026967Species Streptomyces coelicolor [TaxId:1902] [82668] (5 PDB entries)
  8. 1026971Domain d1n5qb_: 1n5q B: [80036]
    complexed with p6g, tnc

Details for d1n5qb_

PDB Entry: 1n5q (more details), 1.74 Å

PDB Description: Crystal structure of a Monooxygenase from the gene ActVA-Orf6 of Streptomyces coelicolor in complex with dehydrated Sancycline
PDB Compounds: (B:) ActaVA-Orf6 monooxygenase

SCOPe Domain Sequences for d1n5qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5qb_ d.58.4.3 (B:) Actinorhodin biosynthesis monooxygenase ActVa-Orf6 {Streptomyces coelicolor [TaxId: 1902]}
aevndprvgfvavvtfpvdgpatqhklvelatggvqewirevpgflsatyhastdgtavv
nyaqweseqayrvnfgadprsaelrealsslpglmgppkavfmtprgailps

SCOPe Domain Coordinates for d1n5qb_:

Click to download the PDB-style file with coordinates for d1n5qb_.
(The format of our PDB-style files is described here.)

Timeline for d1n5qb_: