Lineage for d1n5bb_ (1n5b B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3005912Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 3005913Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) (S)
  5. 3005914Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins)
    the family sequences are very divergent
  6. 3005952Protein YopE chaperone SycE [69637] (2 species)
  7. 3005953Species Yersinia enterocolitica [TaxId:630] [75351] (2 PDB entries)
  8. 3005955Domain d1n5bb_: 1n5b B: [80027]

Details for d1n5bb_

PDB Entry: 1n5b (more details), 2 Å

PDB Description: Crystal Structure Of The Yersinia enterocolitica Molecular Chaperone Syce
PDB Compounds: (B:) YOPE regulator

SCOPe Domain Sequences for d1n5bb_:

Sequence, based on SEQRES records: (download)

>d1n5bb_ d.198.1.1 (B:) YopE chaperone SycE {Yersinia enterocolitica [TaxId: 630]}
sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnnneket
llshnifsqdilkpilswdevgghpvlwnrqplnnldnnslytqlemlvqgaerlqtssl
ispprsfs

Sequence, based on observed residues (ATOM records): (download)

>d1n5bb_ d.198.1.1 (B:) YopE chaperone SycE {Yersinia enterocolitica [TaxId: 630]}
sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnnneket
llshnifsqdilkpilswdevgghpvlwnrqplnnldnnslytqlemlvqgaerlqtrsf
s

SCOPe Domain Coordinates for d1n5bb_:

Click to download the PDB-style file with coordinates for d1n5bb_.
(The format of our PDB-style files is described here.)

Timeline for d1n5bb_: