Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) |
Family d.198.1.1: Type III secretory system chaperone [69636] (10 proteins) the family sequences are very divergent |
Protein YopE chaperone SycE [69637] (2 species) |
Species Yersinia enterocolitica [TaxId:630] [75351] (2 PDB entries) |
Domain d1n5bb_: 1n5b B: [80027] |
PDB Entry: 1n5b (more details), 2 Å
SCOPe Domain Sequences for d1n5bb_:
Sequence, based on SEQRES records: (download)
>d1n5bb_ d.198.1.1 (B:) YopE chaperone SycE {Yersinia enterocolitica [TaxId: 630]} sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnnneket llshnifsqdilkpilswdevgghpvlwnrqplnnldnnslytqlemlvqgaerlqtssl ispprsfs
>d1n5bb_ d.198.1.1 (B:) YopE chaperone SycE {Yersinia enterocolitica [TaxId: 630]} sfeqaitqlfqqlslsipdtiepvigvkvgefachitehpvgqilmftlpsldnnneket llshnifsqdilkpilswdevgghpvlwnrqplnnldnnslytqlemlvqgaerlqtrsf s
Timeline for d1n5bb_: