Lineage for d1n5ak_ (1n5a K:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364355Protein beta2-microglobulin [88600] (4 species)
  7. 364479Species Mouse (Mus musculus) [TaxId:10090] [88603] (59 PDB entries)
  8. 364553Domain d1n5ak_: 1n5a K: [80025]
    Other proteins in same PDB: d1n5aa1, d1n5aa2, d1n5ad1, d1n5ad2, d1n5ag1, d1n5ag2, d1n5aj1, d1n5aj2
    mutant

Details for d1n5ak_

PDB Entry: 1n5a (more details), 2.85 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

SCOP Domain Sequences for d1n5ak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ak_ b.1.1.2 (K:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1n5ak_:

Click to download the PDB-style file with coordinates for d1n5ak_.
(The format of our PDB-style files is described here.)

Timeline for d1n5ak_: