Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries) Uniprot P01887 |
Domain d1n5ah_: 1n5a H: [80022] Other proteins in same PDB: d1n5aa1, d1n5aa2, d1n5ad1, d1n5ad2, d1n5ag1, d1n5ag2, d1n5aj1, d1n5aj2 |
PDB Entry: 1n5a (more details), 2.85 Å
SCOPe Domain Sequences for d1n5ah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n5ah_ b.1.1.2 (H:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1n5ah_: