SCOPe 2.07: Domain d1n5ag2: 1n5a G:2-181

Lineage for d1n5ag2 (1n5a G:2-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries)

8. Domain d1n5ag2: 1n5a G:2-181 [80021]
   Other proteins in same PDB: d1n5aa1, d1n5ab_, d1n5ad1, d1n5ae_, d1n5ag1, d1n5ah_, d1n5aj1, d1n5ak_

Details for d1n5ag2

PDB Entry: 1n5a, 2.85 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1n5ag2:

Sequence; same for both SEQRES and ATOM records:

>d1n5ag2 d.19.1.1 (G:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

Timeline for d1n5ag2:

• d1n5ag2 first appeared in SCOP 1.63
  
• d1n5ag2 appears in SCOPe 2.06
  
• d1n5ag2 appears in the current release, SCOPe 2.08