Lineage for d1n5ag2 (1n5a G:2-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198267Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries)
  8. 1198301Domain d1n5ag2: 1n5a G:2-181 [80021]
    Other proteins in same PDB: d1n5aa1, d1n5ab_, d1n5ad1, d1n5ae_, d1n5ag1, d1n5ah_, d1n5aj1, d1n5ak_

Details for d1n5ag2

PDB Entry: 1n5a (more details), 2.85 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
PDB Compounds: (G:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1n5ag2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ag2 d.19.1.1 (G:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1n5ag2:

Click to download the PDB-style file with coordinates for d1n5ag2.
(The format of our PDB-style files is described here.)

Timeline for d1n5ag2: