Lineage for d1n5ae_ (1n5a E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1105903Protein beta2-microglobulin [88600] (5 species)
  7. 1106406Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
    Uniprot P01887
  8. 1106615Domain d1n5ae_: 1n5a E: [80019]
    Other proteins in same PDB: d1n5aa1, d1n5aa2, d1n5ad1, d1n5ad2, d1n5ag1, d1n5ag2, d1n5aj1, d1n5aj2

Details for d1n5ae_

PDB Entry: 1n5a (more details), 2.85 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d1n5ae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ae_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1n5ae_:

Click to download the PDB-style file with coordinates for d1n5ae_.
(The format of our PDB-style files is described here.)

Timeline for d1n5ae_: