Lineage for d1n5ad2 (1n5a D:1-181)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255210Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 255211Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 255212Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)
  6. 255238Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)
  7. 255332Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (13 PDB entries)
  8. 255351Domain d1n5ad2: 1n5a D:1-181 [80018]
    Other proteins in same PDB: d1n5aa1, d1n5ab_, d1n5ad1, d1n5ae_, d1n5ag1, d1n5ah_, d1n5aj1, d1n5ak_

Details for d1n5ad2

PDB Entry: 1n5a (more details), 2.85 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

SCOP Domain Sequences for d1n5ad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5ad2 d.19.1.1 (D:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOP Domain Coordinates for d1n5ad2:

Click to download the PDB-style file with coordinates for d1n5ad2.
(The format of our PDB-style files is described here.)

Timeline for d1n5ad2: