SCOP 1.65: Domain d1n5aa2: 1n5a A:1-181

Lineage for d1n5aa2 (1n5a A:1-181)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (14 PDB entries)

8. Domain d1n5aa2: 1n5a A:1-181 [80015]
   Other proteins in same PDB: d1n5aa1, d1n5ab_, d1n5ad1, d1n5ae_, d1n5ag1, d1n5ah_, d1n5aj1, d1n5ak_

Details for d1n5aa2

PDB Entry: 1n5a, 2.85 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

SCOP Domain Sequences for d1n5aa2:

Sequence; same for both SEQRES and ATOM records:

>d1n5aa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d1n5aa2:

• d1n5aa2 first appeared in SCOP 1.63
  
• d1n5aa2 appears in SCOP 1.67
  
• d1n5aa2 appears in the current release, SCOPe 2.08