SCOPe 2.07: Domain d1n5aa1: 1n5a A:182-276

Lineage for d1n5aa1 (1n5a A:182-276)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d1n5aa1: 1n5a A:182-276 [80014]
   Other proteins in same PDB: d1n5aa2, d1n5ab_, d1n5ad2, d1n5ae_, d1n5ag2, d1n5ah_, d1n5aj2, d1n5ak_

Details for d1n5aa1

PDB Entry: 1n5a, 2.85 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2db, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1n5aa1:

Sequence; same for both SEQRES and ATOM records:

>d1n5aa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwep

Timeline for d1n5aa1:

• d1n5aa1 first appeared in SCOP 1.63
  
• d1n5aa1 appears in SCOPe 2.06
  
• d1n5aa1 appears in the current release, SCOPe 2.08