Lineage for d1n59d_ (1n59 D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1513477Protein beta2-microglobulin [88600] (5 species)
  7. 1514079Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
    Uniprot P01887
  8. 1514294Domain d1n59d_: 1n59 D: [80013]
    Other proteins in same PDB: d1n59a1, d1n59a2, d1n59c1, d1n59c2

Details for d1n59d_

PDB Entry: 1n59 (more details), 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d1n59d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n59d_ b.1.1.2 (D:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1n59d_:

Click to download the PDB-style file with coordinates for d1n59d_.
(The format of our PDB-style files is described here.)

Timeline for d1n59d_: