Lineage for d1n59c2 (1n59 C:1-181)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2182691Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2183117Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries)
    Uniprot P01901 22-299
  8. 2183174Domain d1n59c2: 1n59 C:1-181 [80012]
    Other proteins in same PDB: d1n59a1, d1n59b_, d1n59c1, d1n59d_

Details for d1n59c2

PDB Entry: 1n59 (more details), 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv
PDB Compounds: (C:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1n59c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n59c2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOPe Domain Coordinates for d1n59c2:

Click to download the PDB-style file with coordinates for d1n59c2.
(The format of our PDB-style files is described here.)

Timeline for d1n59c2: