Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (47 PDB entries) Uniprot P01901 22-299 |
Domain d1n59c2: 1n59 C:1-181 [80012] Other proteins in same PDB: d1n59a1, d1n59b_, d1n59c1, d1n59d_ |
PDB Entry: 1n59 (more details), 2.95 Å
SCOPe Domain Sequences for d1n59c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n59c2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1n59c2:
View in 3D Domains from other chains: (mouse over for more information) d1n59a1, d1n59a2, d1n59b_, d1n59d_ |