SCOPe 2.01: Domain d1n59c2: 1n59 C:1-181

Lineage for d1n59c2 (1n59 C:1-181)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
   Uniprot P01901 22-299

8. Domain d1n59c2: 1n59 C:1-181 [80012]
   Other proteins in same PDB: d1n59a1, d1n59b_, d1n59c1, d1n59d_

Details for d1n59c2

PDB Entry: 1n59, 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

PDB Compounds: (C:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1n59c2:

Sequence; same for both SEQRES and ATOM records:

>d1n59c2 d.19.1.1 (C:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1n59c2:

• d1n59c2 first appeared in SCOP 1.63
  
• d1n59c2 appears in SCOP 1.75
  
• d1n59c2 appears in SCOPe 2.02
  
• d1n59c2 appears in the current release, SCOPe 2.08