SCOP 1.63: Domain d1n59c2: 1n59 C:1-181

Lineage for d1n59c2 (1n59 C:1-181)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (10 proteins)

6. Protein MHC class I, alpha-1 and alpha-2 domains [54468] (19 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (23 PDB entries)

8. Domain d1n59c2: 1n59 C:1-181 [80012]
   Other proteins in same PDB: d1n59a1, d1n59b_, d1n59c1, d1n59d_
   mutant

Details for d1n59c2

PDB Entry: 1n59, 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

SCOP Domain Sequences for d1n59c2:

Sequence; same for both SEQRES and ATOM records:

>d1n59c2 d.19.1.1 (C:1-181) MHC class I, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1n59c2:

• d1n59c2 is new in SCOP 1.63
  
• d1n59c2 appears in SCOP 1.65
  
• d1n59c2 appears in the current release, SCOPe 2.08