Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries) |
Domain d1n59c1: 1n59 C:182-276 [80011] Other proteins in same PDB: d1n59a2, d1n59b_, d1n59c2, d1n59d_ mutant |
PDB Entry: 1n59 (more details), 2.95 Å
SCOP Domain Sequences for d1n59c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n59c1 b.1.1.2 (C:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrwep
Timeline for d1n59c1:
View in 3D Domains from other chains: (mouse over for more information) d1n59a1, d1n59a2, d1n59b_, d1n59d_ |