SCOP 1.69: Domain d1n59a2: 1n59 A:1-181

Lineage for d1n59a2 (1n59 A:1-181)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (34 PDB entries)

8. Domain d1n59a2: 1n59 A:1-181 [80009]
   Other proteins in same PDB: d1n59a1, d1n59b_, d1n59c1, d1n59d_

Details for d1n59a2

PDB Entry: 1n59, 2.95 Å

PDB Description: crystal structure of the murine class i major histocompatibility complex of h-2kb, b2-microglobulin, and a 9-residue immunodominant peptide epitope gp33 derived from lcmv

SCOP Domain Sequences for d1n59a2:

Sequence; same for both SEQRES and ATOM records:

>d1n59a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1n59a2:

• d1n59a2 first appeared in SCOP 1.63
  
• d1n59a2 appears in SCOP 1.67
  
• d1n59a2 appears in SCOP 1.71
  
• d1n59a2 appears in the current release, SCOPe 2.08