![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) |
![]() | Protein Retinoblastoma tumor suppressor domains [47970] (1 species) contains an additional C-terminal helix |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries) |
![]() | Domain d1n4mb2: 1n4m B:643-785 [79997] bound to the transactivation domain (peptide) of E2F-2 |
PDB Entry: 1n4m (more details), 2.2 Å
SCOP Domain Sequences for d1n4mb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n4mb2 a.74.1.3 (B:643-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)} kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq rlktnilqyastrpptlspiphi
Timeline for d1n4mb2: