SCOP 1.63: Domain d1n4mb2: 1n4m B:643-785

Lineage for d1n4mb2 (1n4m B:643-785)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (4 PDB entries)

8. Domain d1n4mb2: 1n4m B:643-785 [79997]
   bound to the transactivation domain (peptide) of E2F-2

Details for d1n4mb2

PDB Entry: 1n4m, 2.2 Å

PDB Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2

SCOP Domain Sequences for d1n4mb2:

Sequence; same for both SEQRES and ATOM records:

>d1n4mb2 a.74.1.3 (B:643-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq
immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq
rlktnilqyastrpptlspiphi

Timeline for d1n4mb2:

• d1n4mb2 is new in SCOP 1.63
  
• d1n4mb2 appears in SCOP 1.65
  
• d1n4mb2 appears in the current release, SCOPe 2.08