SCOPe 2.02: Domain d1n4ma2: 1n4m A:643-785

Lineage for d1n4ma2 (1n4m A:643-785)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (6 PDB entries)

8. Domain d1n4ma2: 1n4m A:643-785 [79995]
   bound to the transactivation domain (peptide) of E2F-2

Details for d1n4ma2

PDB Entry: 1n4m, 2.2 Å

PDB Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2

PDB Compounds: (A:) Retinoblastoma Pocket

SCOPe Domain Sequences for d1n4ma2:

Sequence; same for both SEQRES and ATOM records:

>d1n4ma2 a.74.1.3 (A:643-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq
immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq
rlktnilqyastrpptlspiphi

Timeline for d1n4ma2:

• d1n4ma2 first appeared in SCOP 1.63
  
• d1n4ma2 appears in SCOPe 2.01
  
• d1n4ma2 appears in SCOPe 2.03
  
• d1n4ma2 appears in the current release, SCOPe 2.08