Lineage for d1n4ma2 (1n4m A:643-785)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215344Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 215345Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 215462Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 215463Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 215464Species Human (Homo sapiens) [TaxId:9606] [47971] (4 PDB entries)
  8. 215468Domain d1n4ma2: 1n4m A:643-785 [79995]

Details for d1n4ma2

PDB Entry: 1n4m (more details), 2.2 Å

PDB Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2

SCOP Domain Sequences for d1n4ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4ma2 a.74.1.3 (A:643-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
kstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldq
immcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmq
rlktnilqyastrpptlspiphi

SCOP Domain Coordinates for d1n4ma2:

Click to download the PDB-style file with coordinates for d1n4ma2.
(The format of our PDB-style files is described here.)

Timeline for d1n4ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4ma1