SCOP 1.69: Domain d1n4ma1: 1n4m A:380-581

Lineage for d1n4ma1 (1n4m A:380-581)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)

6. Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
   contains an additional C-terminal helix

7. Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries)

8. Domain d1n4ma1: 1n4m A:380-581 [79994]

Details for d1n4ma1

PDB Entry: 1n4m, 2.2 Å

PDB Description: Structure of Rb tumor suppressor bound to the transactivation domain of E2F-2

SCOP Domain Sequences for d1n4ma1:

Sequence; same for both SEQRES and ATOM records:

>d1n4ma1 a.74.1.3 (A:380-581) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgagcv
aigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacalevvmatys
rstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhlercehrime
slawlsdsplfdlikqsktreg

Timeline for d1n4ma1:

• d1n4ma1 first appeared in SCOP 1.63
  
• d1n4ma1 appears in SCOP 1.67
  
• d1n4ma1 appears in SCOP 1.71
  
• d1n4ma1 appears in the current release, SCOPe 2.08