Lineage for d1n4ka2 (1n4k A:236-435)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2384842Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2385906Superfamily b.42.6: MIR domain [82109] (3 families) (S)
  5. 2385907Family b.42.6.1: MIR domain [82110] (2 protein domains)
    Pfam PF02815
  6. 2385911Protein IP3 receptor type 1 binding core, domain 1 [82111] (1 species)
  7. 2385912Species Mouse (Mus musculus) [TaxId:10090] [82112] (1 PDB entry)
  8. 2385913Domain d1n4ka2: 1n4k A:236-435 [79993]
    Other proteins in same PDB: d1n4ka1
    complexed with i3p

Details for d1n4ka2

PDB Entry: 1n4k (more details), 2.2 Å

PDB Description: Crystal structure of the inositol 1,4,5-trisphosphate receptor binding core in complex with IP3
PDB Compounds: (A:) Inositol 1,4,5-trisphosphate receptor type 1

SCOPe Domain Sequences for d1n4ka2:

Sequence, based on SEQRES records: (download)

>d1n4ka2 b.42.6.1 (A:236-435) IP3 receptor type 1 binding core, domain 1 {Mouse (Mus musculus) [TaxId: 10090]}
ggdvvrlfhaeqekfltcdehrkkqhvflrttgrqsatsatsskalwevevvqhdpcrgg
agywnslfrfkhlatghylaaevdpdfeeeclefqpsvdpdqdasrsrlrnaqekmvysl
vsvpegndissifeldpttlrggdslvprnsyvrlrhlctntwvhstnipidkeeekpvm
lkigtsplkedkeafaivpv

Sequence, based on observed residues (ATOM records): (download)

>d1n4ka2 b.42.6.1 (A:236-435) IP3 receptor type 1 binding core, domain 1 {Mouse (Mus musculus) [TaxId: 10090]}
ggdvvrlfhaeqekfltcdehrkkqhvflrttgrqsatsatsskalwevevvqlfrfkhl
atghylaaevdmvyslvsvpegndissifeldpyvrlrhlctntwvhstnipidkeeekp
vmlkigtsplkedkeafaivpv

SCOPe Domain Coordinates for d1n4ka2:

Click to download the PDB-style file with coordinates for d1n4ka2.
(The format of our PDB-style files is described here.)

Timeline for d1n4ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4ka1