Lineage for d1n4ka1 (1n4k A:436-602)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 216993Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 216994Superfamily a.118.1: ARM repeat [48371] (12 families) (S)
  5. 217139Family a.118.1.11: IP3 receptor type 1 binding core, domain 2 [81895] (1 protein)
  6. 217140Protein IP3 receptor type 1 binding core, domain 2 [81896] (1 species)
  7. 217141Species Mouse (Mus musculus) [TaxId:10090] [81897] (1 PDB entry)
  8. 217142Domain d1n4ka1: 1n4k A:436-602 [79992]
    Other proteins in same PDB: d1n4ka2
    complexed with i3p

Details for d1n4ka1

PDB Entry: 1n4k (more details), 2.2 Å

PDB Description: Crystal structure of the inositol 1,4,5-trisphosphate receptor binding core in complex with IP3

SCOP Domain Sequences for d1n4ka1:

Sequence, based on SEQRES records: (download)

>d1n4ka1 a.118.1.11 (A:436-602) IP3 receptor type 1 binding core, domain 2 {Mouse (Mus musculus)}
spaevrdldfandaskvlgsiagklekgtitqnerrsvtklledlvyfvtggtnsgqdvl
evvfskpnrerqklmreqnilkqifkllqapftdcgdgpmlrleelgdqrhapfrhicrl
cyrvlrhsqqdyrknqeyiakqfgfmqkqigydvlaedtitallhnn

Sequence, based on observed residues (ATOM records): (download)

>d1n4ka1 a.118.1.11 (A:436-602) IP3 receptor type 1 binding core, domain 2 {Mouse (Mus musculus)}
spaevrdldfandaskvlgsiagklekgtitqnerrsvtklledlvyfvtggtnsgqdvl
evvfskpnrerqklmreqnilkqifkllqapfthapfrhicrlcyrvlrhsqqdyrknqe
yiakqfgfmqkqigydvlaedtitallhnn

SCOP Domain Coordinates for d1n4ka1:

Click to download the PDB-style file with coordinates for d1n4ka1.
(The format of our PDB-style files is described here.)

Timeline for d1n4ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4ka2