Lineage for d1n4ka1 (1n4k A:436-602)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2334533Superfamily a.118.22: IP3 receptor type 1 binding core, domain 2 [100909] (1 family) (S)
    automatically mapped to Pfam PF01365
  5. 2334534Family a.118.22.1: IP3 receptor type 1 binding core, domain 2 [81895] (1 protein)
  6. 2334535Protein IP3 receptor type 1 binding core, domain 2 [81896] (1 species)
  7. 2334536Species Mouse (Mus musculus) [TaxId:10090] [81897] (1 PDB entry)
  8. 2334537Domain d1n4ka1: 1n4k A:436-602 [79992]
    Other proteins in same PDB: d1n4ka2
    complexed with i3p

Details for d1n4ka1

PDB Entry: 1n4k (more details), 2.2 Å

PDB Description: Crystal structure of the inositol 1,4,5-trisphosphate receptor binding core in complex with IP3
PDB Compounds: (A:) Inositol 1,4,5-trisphosphate receptor type 1

SCOPe Domain Sequences for d1n4ka1:

Sequence, based on SEQRES records: (download)

>d1n4ka1 a.118.22.1 (A:436-602) IP3 receptor type 1 binding core, domain 2 {Mouse (Mus musculus) [TaxId: 10090]}
spaevrdldfandaskvlgsiagklekgtitqnerrsvtklledlvyfvtggtnsgqdvl
evvfskpnrerqklmreqnilkqifkllqapftdcgdgpmlrleelgdqrhapfrhicrl
cyrvlrhsqqdyrknqeyiakqfgfmqkqigydvlaedtitallhnn

Sequence, based on observed residues (ATOM records): (download)

>d1n4ka1 a.118.22.1 (A:436-602) IP3 receptor type 1 binding core, domain 2 {Mouse (Mus musculus) [TaxId: 10090]}
spaevrdldfandaskvlgsiagklekgtitqnerrsvtklledlvyfvtggtnsgqdvl
evvfskpnrerqklmreqnilkqifkllqapfthapfrhicrlcyrvlrhsqqdyrknqe
yiakqfgfmqkqigydvlaedtitallhnn

SCOPe Domain Coordinates for d1n4ka1:

Click to download the PDB-style file with coordinates for d1n4ka1.
(The format of our PDB-style files is described here.)

Timeline for d1n4ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n4ka2