Lineage for d1n4ga_ (1n4g A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004955Protein Cyp121 monooxygenase (P450 Mt2) [81865] (2 species)
  7. 2004956Species Mycobacterium tuberculosis [TaxId:1773] [81866] (35 PDB entries)
  8. 2004985Domain d1n4ga_: 1n4g A: [79991]
    complexed with hem, pyz

Details for d1n4ga_

PDB Entry: 1n4g (more details), 1.8 Å

PDB Description: Structure of CYP121, a Mycobacterial P450, in Complex with Iodopyrazole
PDB Compounds: (A:) Cytochrome P450 121

SCOPe Domain Sequences for d1n4ga_:

Sequence, based on SEQRES records: (download)

>d1n4ga_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
lkkmpgvdlavpidqlvwrtrfqrriperlpvlw

Sequence, based on observed residues (ATOM records): (download)

>d1n4ga_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkaleqflrdtanslldnl
itegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinwdr
dieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfltt
alisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkgel
vlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieallk
kmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d1n4ga_:

Click to download the PDB-style file with coordinates for d1n4ga_.
(The format of our PDB-style files is described here.)

Timeline for d1n4ga_: