Lineage for d1n47d_ (1n47 D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2373210Protein Legume lectin [49904] (23 species)
  7. 2373310Species Hairy vetch (Vicia villosa), isolectin b4 [TaxId:3911] [82033] (1 PDB entry)
  8. 2373314Domain d1n47d_: 1n47 D: [79986]
    complexed with ca, mn, tnr

Details for d1n47d_

PDB Entry: 1n47 (more details), 2.7 Å

PDB Description: Isolectin B4 from Vicia villosa in complex with the Tn antigen
PDB Compounds: (D:) Isolectin B4

SCOPe Domain Sequences for d1n47d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n47d_ b.29.1.1 (D:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]}
testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla

SCOPe Domain Coordinates for d1n47d_:

Click to download the PDB-style file with coordinates for d1n47d_.
(The format of our PDB-style files is described here.)

Timeline for d1n47d_: