Lineage for d1n47c_ (1n47 C:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663444Species Hairy vetch (Vicia villosa), isolectin b4 [TaxId:3911] [82033] (1 PDB entry)
  8. 663447Domain d1n47c_: 1n47 C: [79985]

Details for d1n47c_

PDB Entry: 1n47 (more details), 2.7 Å

PDB Description: Isolectin B4 from Vicia villosa in complex with the Tn antigen
PDB Compounds: (C:) Isolectin B4

SCOP Domain Sequences for d1n47c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n47c_ b.29.1.1 (C:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]}
testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla

SCOP Domain Coordinates for d1n47c_:

Click to download the PDB-style file with coordinates for d1n47c_.
(The format of our PDB-style files is described here.)

Timeline for d1n47c_: