SCOP 1.73: Domain d1n47c_: 1n47 C:

Lineage for d1n47c_ (1n47 C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Hairy vetch (Vicia villosa), isolectin b4 [TaxId:3911] [82033] (1 PDB entry)

8. Domain d1n47c_: 1n47 C: [79985]

Details for d1n47c_

PDB Entry: 1n47, 2.7 Å

PDB Description: isolectin b4 from vicia villosa in complex with the tn antigen

PDB Compounds: (C:) Isolectin B4

SCOP Domain Sequences for d1n47c_:

Sequence; same for both SEQRES and ATOM records:

>d1n47c_ b.29.1.1 (C:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]}
testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla

Timeline for d1n47c_:

• d1n47c_ first appeared in SCOP 1.63
  
• d1n47c_ appears in SCOP 1.71
  
• d1n47c_ appears in SCOP 1.75
  
• d1n47c_ appears in the current release, SCOPe 2.08