Lineage for d1n47c_ (1n47 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778587Species Hairy vetch (Vicia villosa), isolectin b4 [TaxId:3911] [82033] (1 PDB entry)
  8. 2778590Domain d1n47c_: 1n47 C: [79985]
    complexed with a2g, ca, mn, ser

Details for d1n47c_

PDB Entry: 1n47 (more details), 2.7 Å

PDB Description: isolectin b4 from vicia villosa in complex with the tn antigen
PDB Compounds: (C:) Isolectin B4

SCOPe Domain Sequences for d1n47c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n47c_ b.29.1.1 (C:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]}
testsfsftnfnpnqnnlilqedalvnsagtleltavaagapvpdslgralyaapihihd
nttlasfttsfsfvmaapaaaavadglafflappdtqpqarggflglfadrahdasyqtv
avefdtysnawdpnythigidtngieskkttpfdmvygekanivityqastkalaaslvf
pvsqtsyavsarvdlrdilpeyvrvgfsattglnagvvethdivswsfavsla

SCOPe Domain Coordinates for d1n47c_:

Click to download the PDB-style file with coordinates for d1n47c_.
(The format of our PDB-style files is described here.)

Timeline for d1n47c_: