SCOP 1.63: Domain d1n45b_: 1n45 B:

Lineage for d1n45b_ (1n45 B:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.132: Heme oxygenase [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase [48613] (2 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.1: Eukaryotic heme oxygenase [48614] (1 protein)

6. Protein Heme oxygenase-1 (HO-1) [48615] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48616] (2 PDB entries)

8. Domain d1n45b_: 1n45 B: [79982]
   complexed with hem, so4

Details for d1n45b_

PDB Entry: 1n45, 1.5 Å

PDB Description: x-ray crystal structure of human heme oxygenase-1 (ho-1) in complex with its substrate heme

SCOP Domain Sequences for d1n45b_:

Sequence; same for both SEQRES and ATOM records:

>d1n45b_ a.132.1.1 (B:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens)}
pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
emtpavrqrvieeaktafllniqlfeelqellth

Timeline for d1n45b_:

• d1n45b_ is new in SCOP 1.63
  
• d1n45b_ appears in SCOP 1.65
  
• d1n45b_ appears in the current release, SCOPe 2.08